PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0012s0500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 390aa    MW: 43096 Da    PI: 8.8516
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0012s0500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.2e-3998157261
                  zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                             +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk++
  SapurV1A.0012s0500.1.p  98 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRV 157
                             7899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3097156IPR003851Zinc finger, Dof-type
PfamPF027011.1E-33100156IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.525102156IPR003851Zinc finger, Dof-type
PROSITE patternPS013610104140IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MATGSSPPLS LSSPLSFSII GQNMTRFLFL SFWKRISIER CYFYANKNTT LDVFLFVFLF  60
FYFPFSLVQN QIDEKSLMES TSKLMERRGE EVLSQPQQQQ ALKCPRCDSS NTKFCYYNNY  120
SLSQPRHFCK ACKRYWTRGG TLRNVPVGGG CRKNKRVRRP ASAVDGANNS VSSANPNPQT  180
PTDPISSTSN HINPLFYGLT SSNPSEMDLS FTGRFNSRGY SAVSGYHDLQ PQLNSLALGF  240
SSGIMSADHD ANGFNHTKQI QDVVTSNSLL SSYSNFFGSA TTSTNTTSPT IASLLASSFN  300
QQKSTTRAPN QYQSLTVPFE DLQMSGNSES GIGVKGVKTE HDQNRSSWNV PCQNQIEQVG  360
FSDPSMYWNT TTSVGSWHDP ANMGSSVLL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1647380.0KT164738.1 Populus tomentosa clone Potom.011G26508 F-box family protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027799.10.0PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLB9N3H41e-173B9N3H4_POPTR; Uncharacterized protein
STRINGPOPTR_0011s05450.11e-173(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.11e-37Dof family protein